PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf08002g01002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 463aa    MW: 50781.7 Da    PI: 5.0247
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf08002g01002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.7e-39111170261
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                               ++k+l+cprC+s++tkfCy+nny++sqPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s
  Niben101Scf08002g01002.1 111 PDKILPCPRCNSMETKFCYFNNYNVSQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNS 170
                               68999****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-29108168IPR003851Zinc finger, Dof-type
PfamPF027015.1E-32113169IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.798115169IPR003851Zinc finger, Dof-type
PROSITE patternPS013610117153IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MSELKDPAIK LFGKTIHLPD IQDDSSPEET NEEEEEDVQT HKDDFGGNLD DDKDEMGTLT  60
GKELQDQNSD HSRSDTIEGQ PVDNDGSTRP SKSEEEQGEA SNSQEKILKR PDKILPCPRC  120
NSMETKFCYF NNYNVSQPRH FCKNCQRYWT AGGTMRNVPV GAGRRKNKNS ISHYRQISVS  180
ETLPNAQTDY PNGIQQPILA FGSHKPLCES MASVLSIADK TMHNCSPNGF HKPEESGVQV  240
SYGAGDNGDD HSRRSSVTAA NSEDEVKIGP DLLRKNCPSF PPYLTCYPGA AWPYPCSSVH  300
WTSAVPTPGY FPPVFPTPFY PTAAYWGYNV AGSWNVPLVS PPTASLTQTP PTSGPNSPLG  360
KHSRDENILK PLNSTEEPSR ESNHEKCLWV PKTLRIDDPG EAAKSSIWST LGIKHDSVDS  420
VGGSPFSAFQ SKNDGNNSVS ENSTVLQANP AGLSRSQNFN EGL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774295.10.0PREDICTED: cyclic dof factor 3-like
RefseqXP_016473415.10.0PREDICTED: cyclic dof factor 3-like
TrEMBLA0A0V0IGG60.0A0A0V0IGG6_SOLCH; Putative cyclic dof factor 2-like
STRINGPGSC0003DMT4000646950.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-91cycling DOF factor 2